USP34 (Ubiquitin-specific-processing Protease 34, Ubiquitin Carboxyl-terminal Hydrolase 34, Deubiquitinating Enzyme 34, Ubiquitin Thioesterase 34, KIAA0570, KIAA0729) (APC), Clone: [2E2], Mouse, Monoclonal

Catalog Number: USB-135172-APC
Article Name: USP34 (Ubiquitin-specific-processing Protease 34, Ubiquitin Carboxyl-terminal Hydrolase 34, Deubiquitinating Enzyme 34, Ubiquitin Thioesterase 34, KIAA0570, KIAA0729) (APC), Clone: [2E2], Mouse, Monoclonal
Biozol Catalog Number: USB-135172-APC
Supplier Catalog Number: 135172-APC
Alternative Catalog Number: USB-135172-APC-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: FLISA, IF, IHC, WB
Immunogen: Partial recombinant corresponding to aa3296-3395 from USP34 (NP_055524) with GST tag. MW of the GST tag alone is 26kD.
Applications: Suitable for use in FLISA, Immunohistochemistry, Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: CKEFKDLHCSKDSTLAEEESEFPSTSISAVLSDLADLRSCDGQALPSQDPEVALSLSCGHSRGLFSHMQQHDILDTLCRTIESTIHVVTRISGKGNQAAS Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [2E2]
NCBI: 014709
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).