USP34 (Ubiquitin-specific-processing Protease 34, Ubiquitin Carboxyl-terminal Hydrolase 34, Deubiquitinating Enzyme 34, Ubiquitin Thioesterase 34, KIAA0570, KIAA0729) (APC), Clone: [2E2], Mouse, Monoclonal

Artikelnummer: USB-135172-APC
Artikelname: USP34 (Ubiquitin-specific-processing Protease 34, Ubiquitin Carboxyl-terminal Hydrolase 34, Deubiquitinating Enzyme 34, Ubiquitin Thioesterase 34, KIAA0570, KIAA0729) (APC), Clone: [2E2], Mouse, Monoclonal
Artikelnummer: USB-135172-APC
Hersteller Artikelnummer: 135172-APC
Alternativnummer: USB-135172-APC-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: FLISA, IF, IHC, WB
Immunogen: Partial recombinant corresponding to aa3296-3395 from USP34 (NP_055524) with GST tag. MW of the GST tag alone is 26kD.
Applications: Suitable for use in FLISA, Immunohistochemistry, Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: CKEFKDLHCSKDSTLAEEESEFPSTSISAVLSDLADLRSCDGQALPSQDPEVALSLSCGHSRGLFSHMQQHDILDTLCRTIESTIHVVTRISGKGNQAAS Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [2E2]
NCBI: 014709
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).