Intercellular Adhesion Molecule-1, Human Recombinant HEK
Catalog Number:
RAY-228-21751-3
- Images (0)
| Article Name: | Intercellular Adhesion Molecule-1, Human Recombinant HEK |
| Biozol Catalog Number: | RAY-228-21751-3 |
| Supplier Catalog Number: | 228-21751-3 |
| Alternative Catalog Number: | RAY-228-21751-3 |
| Manufacturer: | RayBiotech |
| Category: | Proteine/Peptide |
| Species Reactivity: | Human |
| Alternative Names: | Intercellular adhesion molecule 1, ICAM-1, Major group rhinovirus receptor, CD54 antigen, ICAM1, BB2, CD54, P3.58. |
| NCBI: | 3383 |
| Expression System: | HEK293 cells |
| Purity: | Greater than 95% as determined by SDS-PAGE. |
| Form: | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Sequence: | QTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAED |
| Formula: | ICAM1 was lyophilized from a 0.2 uM filtered solution of 20mM PB and 150mM NaCl, pH 7.2. |
Product Guarantee and Expert Support
