Intercellular Adhesion Molecule-1, Human Recombinant HEK
Artikelnummer:
RAY-228-21751-3
| Artikelname: |
Intercellular Adhesion Molecule-1, Human Recombinant HEK |
| Artikelnummer: |
RAY-228-21751-3 |
| Hersteller Artikelnummer: |
228-21751-3 |
| Alternativnummer: |
RAY-228-21751-3 |
| Hersteller: |
RayBiotech |
| Kategorie: |
Proteine/Peptide |
| Spezies Reaktivität: |
Human |
| Alternative Synonym: |
Intercellular adhesion molecule 1, ICAM-1, Major group rhinovirus receptor, CD54 antigen, ICAM1, BB2, CD54, P3.58. |
| NCBI: |
3383 |
| Expression System: |
HEK293 cells |
| Reinheit: |
Greater than 95% as determined by SDS-PAGE. |
| Formulierung: |
Sterile Filtered White lyophilized (freeze-dried) powder. |
| Sequenz: |
QTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAED |
| Formel: |
ICAM1 was lyophilized from a 0.2 uM filtered solution of 20mM PB and 150mM NaCl, pH 7.2. |