Vascular cell adhesion molecule 1, Human Recombinant HEK
Catalog Number:
RAY-228-21749-3
- Images (0)
| Article Name: | Vascular cell adhesion molecule 1, Human Recombinant HEK |
| Biozol Catalog Number: | RAY-228-21749-3 |
| Supplier Catalog Number: | 228-21749-3 |
| Alternative Catalog Number: | RAY-228-21749-3 |
| Manufacturer: | RayBiotech |
| Category: | Proteine/Peptide |
| Species Reactivity: | Human |
| Alternative Names: | Vascular cell adhesion protein 1, V-CAM 1, INCAM-100, CD106, VCAM1, L1CAM, MGC99561, DKFZp779G2333. |
| NCBI: | 7412 |
| Expression System: | HEK293 cells |
| Purity: | Greater than 95% as determined by SDS-PAGE. |
| Form: | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Sequence: | FKIETTPESRYLAQIGDSVSLTCSTTGCESPFFSWRTQIDSPLNGKVTNEGTTSTLTMNPVSFGNEHSYLCTATCESRKLEKGIQVEIYSFPKDPEIHLSGPLEAGKPITVKCSVADVYPFDRLEIDLLKGDHLMKSQEFLEDADRKSLETKSLEVTFTPVIEDIGKVLVCRAKLHIDEMDSVPTVRQAVKELQVYISPKNTVISVNPSTKLQEGGSVTMTCSSEGLPAPEIFWSKKLDNGNLQHLSGNATLTLI |
| Formula: | VCAM1 was lyophilized from a 0.2 umfiltered solution of 20mM PB, 150mM NaCl, 2mM CaCl2, 2mM MgCl2 and 5%Threhalose, pH 7.2. |
Product Guarantee and Expert Support
