Vascular cell adhesion molecule 1, Human Recombinant HEK

Catalog Number: RAY-228-21749-3
Article Name: Vascular cell adhesion molecule 1, Human Recombinant HEK
Biozol Catalog Number: RAY-228-21749-3
Supplier Catalog Number: 228-21749-3
Alternative Catalog Number: RAY-228-21749-3
Manufacturer: RayBiotech
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: Vascular cell adhesion protein 1, V-CAM 1, INCAM-100, CD106, VCAM1, L1CAM, MGC99561, DKFZp779G2333.
NCBI: 7412
Expression System: HEK293 cells
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: FKIETTPESRYLAQIGDSVSLTCSTTGCESPFFSWRTQIDSPLNGKVTNEGTTSTLTMNPVSFGNEHSYLCTATCESRKLEKGIQVEIYSFPKDPEIHLSGPLEAGKPITVKCSVADVYPFDRLEIDLLKGDHLMKSQEFLEDADRKSLETKSLEVTFTPVIEDIGKVLVCRAKLHIDEMDSVPTVRQAVKELQVYISPKNTVISVNPSTKLQEGGSVTMTCSSEGLPAPEIFWSKKLDNGNLQHLSGNATLTLI
Formula: VCAM1 was lyophilized from a 0.2 umfiltered solution of 20mM PB, 150mM NaCl, 2mM CaCl2, 2mM MgCl2 and 5%Threhalose, pH 7.2.