Vascular cell adhesion molecule 1, Human Recombinant HEK
Artikelnummer:
RAY-228-21749-3
- Bilder (0)
| Artikelname: | Vascular cell adhesion molecule 1, Human Recombinant HEK |
| Artikelnummer: | RAY-228-21749-3 |
| Hersteller Artikelnummer: | 228-21749-3 |
| Alternativnummer: | RAY-228-21749-3 |
| Hersteller: | RayBiotech |
| Kategorie: | Proteine/Peptide |
| Spezies Reaktivität: | Human |
| Alternative Synonym: | Vascular cell adhesion protein 1, V-CAM 1, INCAM-100, CD106, VCAM1, L1CAM, MGC99561, DKFZp779G2333. |
| NCBI: | 7412 |
| Expression System: | HEK293 cells |
| Reinheit: | Greater than 95% as determined by SDS-PAGE. |
| Formulierung: | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Sequenz: | FKIETTPESRYLAQIGDSVSLTCSTTGCESPFFSWRTQIDSPLNGKVTNEGTTSTLTMNPVSFGNEHSYLCTATCESRKLEKGIQVEIYSFPKDPEIHLSGPLEAGKPITVKCSVADVYPFDRLEIDLLKGDHLMKSQEFLEDADRKSLETKSLEVTFTPVIEDIGKVLVCRAKLHIDEMDSVPTVRQAVKELQVYISPKNTVISVNPSTKLQEGGSVTMTCSSEGLPAPEIFWSKKLDNGNLQHLSGNATLTLI |
| Formel: | VCAM1 was lyophilized from a 0.2 umfiltered solution of 20mM PB, 150mM NaCl, 2mM CaCl2, 2mM MgCl2 and 5%Threhalose, pH 7.2. |
Produktgarantie und fachkundiger Support
