Anti-BD-1 (32-66) Antibody, Polyclonal

Catalog Number: RAY-130-10577-500
Article Name: Anti-BD-1 (32-66) Antibody, Polyclonal
Biozol Catalog Number: RAY-130-10577-500
Supplier Catalog Number: 130-10577-500
Alternative Catalog Number: RAY-130-10577-500
Manufacturer: RayBiotech
Category: Antikörper
Species Reactivity: Human
Immunogen: This antibody was produced from antiserum of rabbits immunized with a synthetic immunogen BD-1(32-66):DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKC). This antibody was produced from a rabbit immunized with this peptide conjugated with KLH.The IgG fraction was purified by Protein A affinity chromatography.
Rabbit anti-Human BD-1(32-66) Antibody
Clonality: Polyclonal
NCBI: 1672
UniProt: P60022
Sequence: DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKC
Application Notes: ELISA (recommended work dilution= 1:128,000)