Anti-BD-1 (32-66) Antibody, Polyclonal

Artikelnummer: RAY-130-10577-500

Artikelname:	Anti-BD-1 (32-66) Antibody, Polyclonal
Artikelnummer:	RAY-130-10577-500
Hersteller Artikelnummer:	130-10577-500
Alternativnummer:	RAY-130-10577-500
Hersteller:	RayBiotech
Kategorie:	Antikörper
Spezies Reaktivität:	Human
Immunogen:	This antibody was produced from antiserum of rabbits immunized with a synthetic immunogen BD-1(32-66):DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKC). This antibody was produced from a rabbit immunized with this peptide conjugated with KLH.The IgG fraction was purified by Protein A affinity chromatography.

Rabbit anti-Human BD-1(32-66) Antibody

Klonalität:	Polyclonal
NCBI:	1672
UniProt:	P60022
Sequenz:	DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKC

Anwendungsbeschreibung:

ELISA (recommended work dilution= 1:128,000)

* Mehrwertsteuer und Versandkosten nicht enthalten.
Irrtümer und Preisänderungen vorbehalten