Polyclonal Rabbit anti-Human GNRH Antibody (IHC, WB) LS-C334177

Catalog Number: LS-C334177-100
Article Name: Polyclonal Rabbit anti-Human GNRH Antibody (IHC, WB) LS-C334177
Biozol Catalog Number: LS-C334177-100
Supplier Catalog Number: LS-C334177-100
Alternative Catalog Number: LS-C334177-100
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 24-92 of human GNRH1 (NP_001076580.1). QHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRSPLRDLKGALESLIEEETGQKKI
Conjugation: Unconjugated
Alternative Names: GNRH1, Gonadoliberin, LHRH, LNRH, GnRH-associated peptide 1, Progonadoliberin-1, Progonadoliberin I, Luliberin I, GNRH, GRH, HH12
GNRH antibody LS-C334177 is an unconjugated rabbit polyclonal antibody to GNRH from human. It is reactive with human and mouse. Validated for IHC and WB.
Clonality: Polyclonal
NCBI: 2796
Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Purity: Affinity purified
Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Dilute: IHC (1:50 - 1:100), WB (1:500 - 1:2000)
Application Notes: The predicted MW is 10kDa, while the observed MW by Western blot was 12kDa.
Western blot analysis of extracts of various tissues.
Immunohistochemistry of paraffin-embedded human prostate.
698,00 €
100 µl
* VAT and and shipping costs not included.
Errors and price changes excepted
Availability
ORDER BY EMAIL
Product Guarantee and Expert Support
BIOZOL