Polyclonal Rabbit anti-Human GNRH Antibody (IHC, WB) LS-C334177

Artikelnummer: LS-C334177-100

Bilder (2)
Sehen Sie alle Bilder und Bildinformationen

Artikelname:	Polyclonal Rabbit anti-Human GNRH Antibody (IHC, WB) LS-C334177
Artikelnummer:	LS-C334177-100
Hersteller Artikelnummer:	LS-C334177-100
Alternativnummer:	LS-C334177-100
Hersteller:	LifeSpan Biosciences
Wirt:	Rabbit
Kategorie:	Antikörper
Applikation:	IHC, WB
Spezies Reaktivität:	Human, Mouse
Immunogen:	Recombinant fusion protein containing a sequence corresponding to amino acids 24-92 of human GNRH1 (NP_001076580.1). QHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRSPLRDLKGALESLIEEETGQKKI
Konjugation:	Unconjugated
Alternative Synonym:	GNRH1, Gonadoliberin, LHRH, LNRH, GnRH-associated peptide 1, Progonadoliberin-1, Progonadoliberin I, Luliberin I, GNRH, GRH, HH12

GNRH antibody LS-C334177 is an unconjugated rabbit polyclonal antibody to GNRH from human. It is reactive with human and mouse. Validated for IHC and WB.

Klonalität:	Polyclonal
NCBI:	2796
Puffer:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit:	Affinity purified
Formulierung:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Verdünnung:	IHC (1:50 - 1:100), WB (1:500 - 1:2000)
Anwendungsbeschreibung:	The predicted MW is 10kDa, while the observed MW by Western blot was 12kDa.

	Western blot analysis of extracts of various tissues.
	Immunohistochemistry of paraffin-embedded human prostate.

* Mehrwertsteuer und Versandkosten nicht enthalten.
Irrtümer und Preisänderungen vorbehalten