Polyclonal Rabbit anti-Human DBI / ACBD1 Antibody (IHC, IF, WB) LS-C334019

Catalog Number: LS-C334019-100
Article Name: Polyclonal Rabbit anti-Human DBI / ACBD1 Antibody (IHC, IF, WB) LS-C334019
Biozol Catalog Number: LS-C334019-100
Supplier Catalog Number: LS-C334019-100
Alternative Catalog Number: LS-C334019-100
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Application: IF, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-114 of human DBI (NP_001171513.1). MWGDLWLLPPASANPGTGTEAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI
Conjugation: Unconjugated
Alternative Names: DBI, ACBP, Acyl-CoA-binding protein, CCK-RP, ACBD1, GABA receptor modulator, EP, Endozepine
ACBD1 antibody LS-C334019 is an unconjugated rabbit polyclonal antibody to human ACBD1 (DBI). Validated for IF, IHC and WB.
Clonality: Polyclonal
NCBI: 1622
Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Purity: Affinity purified
Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Dilute: IF (1:50 - 1:200), IHC (1:50 - 1:200), WB (1:500 - 1:2000)
Application Notes: The predicted MW is 10kDa/11kDa/13kDa/14kDa/16kDa, while the observed MW by Western blot was 12kDa.
Western blot analysis of extracts of various cell lines.
Immunofluorescence analysis of MCF-7 cells.