Polyclonal Rabbit anti-Human DBI / ACBD1 Antibody (IHC, IF, WB) LS-C334019

Artikelnummer: LS-C334019-100
Artikelname: Polyclonal Rabbit anti-Human DBI / ACBD1 Antibody (IHC, IF, WB) LS-C334019
Artikelnummer: LS-C334019-100
Hersteller Artikelnummer: LS-C334019-100
Alternativnummer: LS-C334019-100
Hersteller: LifeSpan Biosciences
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IF, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-114 of human DBI (NP_001171513.1). MWGDLWLLPPASANPGTGTEAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI
Konjugation: Unconjugated
Alternative Synonym: DBI, ACBP, Acyl-CoA-binding protein, CCK-RP, ACBD1, GABA receptor modulator, EP, Endozepine
ACBD1 antibody LS-C334019 is an unconjugated rabbit polyclonal antibody to human ACBD1 (DBI). Validated for IF, IHC and WB.
Klonalität: Polyclonal
NCBI: 1622
Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit: Affinity purified
Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Verdünnung: IF (1:50 - 1:200), IHC (1:50 - 1:200), WB (1:500 - 1:2000)
Anwendungsbeschreibung: The predicted MW is 10kDa/11kDa/13kDa/14kDa/16kDa, while the observed MW by Western blot was 12kDa.
Western blot analysis of extracts of various cell lines.
Immunofluorescence analysis of MCF-7 cells.