Polyclonal Rabbit anti-Human GLRX / Glutaredoxin Antibody (IHC, IF, WB) LS-C333977

Catalog Number: LS-C333977-100

Images (2)
See all images and image information

Article Name:	Polyclonal Rabbit anti-Human GLRX / Glutaredoxin Antibody (IHC, IF, WB) LS-C333977
Biozol Catalog Number:	LS-C333977-100
Supplier Catalog Number:	LS-C333977-100
Alternative Catalog Number:	LS-C333977-100
Manufacturer:	LifeSpan Biosciences
Host:	Rabbit
Category:	Antikörper
Application:	IF, IHC, WB
Species Reactivity:	Human, Mouse, Rat
Immunogen:	Recombinant fusion protein containing a sequence corresponding to amino acids 1-106 of human GLRX (NP_001112362.1). MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIGALQ
Conjugation:	Unconjugated
Alternative Names:	GLRX, Glutaredoxin-1, Glutaredoxin, GRX1, Thioltransferase-1, GRX, TTase-1

Glutaredoxin antibody LS-C333977 is an unconjugated rabbit polyclonal antibody to Glutaredoxin (GLRX) from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB.

Clonality:	Polyclonal
NCBI:	2745
Buffer:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Purity:	Affinity purified
Form:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Dilute:	IF (1:50 - 1:200), IHC (1:50 - 1:200), WB (1:500 - 1:2000)
Application Notes:	The predicted MW is 11kDa, while the observed MW by Western blot was 12kDa.

	Western blot analysis of extracts of various cel
	Immunofluorescence analysis of MCF-7 cell using GLRX antibody. Blue: DAPI for nuclear staining.

* VAT and and shipping costs not included.
Errors and price changes excepted