Polyclonal Rabbit anti-Human GLRX / Glutaredoxin Antibody (IHC, IF, WB) LS-C333977

Artikelnummer: LS-C333977-100
Artikelname: Polyclonal Rabbit anti-Human GLRX / Glutaredoxin Antibody (IHC, IF, WB) LS-C333977
Artikelnummer: LS-C333977-100
Hersteller Artikelnummer: LS-C333977-100
Alternativnummer: LS-C333977-100
Hersteller: LifeSpan Biosciences
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IF, IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-106 of human GLRX (NP_001112362.1). MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIGALQ
Konjugation: Unconjugated
Alternative Synonym: GLRX, Glutaredoxin-1, Glutaredoxin, GRX1, Thioltransferase-1, GRX, TTase-1
Glutaredoxin antibody LS-C333977 is an unconjugated rabbit polyclonal antibody to Glutaredoxin (GLRX) from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB.
Klonalität: Polyclonal
NCBI: 2745
Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit: Affinity purified
Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Verdünnung: IF (1:50 - 1:200), IHC (1:50 - 1:200), WB (1:500 - 1:2000)
Anwendungsbeschreibung: The predicted MW is 11kDa, while the observed MW by Western blot was 12kDa.
Western blot analysis of extracts of various cel
Immunofluorescence analysis of MCF-7 cell using GLRX antibody. Blue: DAPI for nuclear staining.