Polyclonal Rabbit anti-Human DAP-5 / EIF4G2 Antibody (IHC, WB) LS-C332278

Catalog Number: LS-C332278-100

Images (2)
See all images and image information

Article Name:	Polyclonal Rabbit anti-Human DAP-5 / EIF4G2 Antibody (IHC, WB) LS-C332278
Biozol Catalog Number:	LS-C332278-100
Supplier Catalog Number:	LS-C332278-100
Alternative Catalog Number:	LS-C332278-100
Manufacturer:	LifeSpan Biosciences
Host:	Rabbit
Category:	Antikörper
Application:	IHC, WB
Species Reactivity:	Human, Mouse, Rat
Immunogen:	A synthetic peptide corresponding to a sequence within amino acids 750-850 of human EIF4G2 (NP_001409.3). IYKWIKDNISPKLHVDKGFVNILMTSFLQYISSEVNPPSDETDSSSAPSKEQLEQEKQLLLSFKPVMQKFLHDHVDLQVSALYALQVHCYNSNFPKGMLLR
Conjugation:	Unconjugated
Alternative Names:	EIF4G2, AAG1, Aging-associated protein 1, DAP-5, DAP5, Death-associated protein 5, EIF-4G 2, EIF-4-gamma 2, EIF4G 2, Translation repressor nat1, p97

EIF4G2 antibody LS-C332278 is an unconjugated rabbit polyclonal antibody to EIF4G2 (DAP-5) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.

Clonality:	Polyclonal
NCBI:	1982
Buffer:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Purity:	Affinity purified
Form:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Dilute:	IHC (1:100 - 1:200), WB (1:500 - 1:1000)
Application Notes:	The predicted MW is 98kDa/102kDa, while the observed MW by Western blot was 110kDa.

	Western blot analysis of extracts of various cell lines.
	Immunohistochemistry of paraffin-embedded human liver injury tissue.

* VAT and and shipping costs not included.
Errors and price changes excepted