Polyclonal Rabbit anti-Human DAP-5 / EIF4G2 Antibody (IHC, WB) LS-C332278

Artikelnummer: LS-C332278-100

Bilder (2)
Sehen Sie alle Bilder und Bildinformationen

Artikelname:	Polyclonal Rabbit anti-Human DAP-5 / EIF4G2 Antibody (IHC, WB) LS-C332278
Artikelnummer:	LS-C332278-100
Hersteller Artikelnummer:	LS-C332278-100
Alternativnummer:	LS-C332278-100
Hersteller:	LifeSpan Biosciences
Wirt:	Rabbit
Kategorie:	Antikörper
Applikation:	IHC, WB
Spezies Reaktivität:	Human, Mouse, Rat
Immunogen:	A synthetic peptide corresponding to a sequence within amino acids 750-850 of human EIF4G2 (NP_001409.3). IYKWIKDNISPKLHVDKGFVNILMTSFLQYISSEVNPPSDETDSSSAPSKEQLEQEKQLLLSFKPVMQKFLHDHVDLQVSALYALQVHCYNSNFPKGMLLR
Konjugation:	Unconjugated
Alternative Synonym:	EIF4G2, AAG1, Aging-associated protein 1, DAP-5, DAP5, Death-associated protein 5, EIF-4G 2, EIF-4-gamma 2, EIF4G 2, Translation repressor nat1, p97

EIF4G2 antibody LS-C332278 is an unconjugated rabbit polyclonal antibody to EIF4G2 (DAP-5) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.

Klonalität:	Polyclonal
NCBI:	1982
Puffer:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit:	Affinity purified
Formulierung:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Verdünnung:	IHC (1:100 - 1:200), WB (1:500 - 1:1000)
Anwendungsbeschreibung:	The predicted MW is 98kDa/102kDa, while the observed MW by Western blot was 110kDa.

	Western blot analysis of extracts of various cell lines.
	Immunohistochemistry of paraffin-embedded human liver injury tissue.

* Mehrwertsteuer und Versandkosten nicht enthalten.
Irrtümer und Preisänderungen vorbehalten