Polyclonal Rabbit anti-Human ATG4A Antibody (IHC, WB) LS-C332196

Catalog Number: LS-C332196-20

Images (2)
See all images and image information

Article Name:	Polyclonal Rabbit anti-Human ATG4A Antibody (IHC, WB) LS-C332196
Biozol Catalog Number:	LS-C332196-20
Supplier Catalog Number:	LS-C332196-20
Alternative Catalog Number:	LS-C332196-20
Manufacturer:	LifeSpan Biosciences
Host:	Rabbit
Category:	Antikörper
Application:	IHC, IP, WB
Species Reactivity:	Human, Mouse
Immunogen:	Recombinant fusion protein containing a sequence corresponding to amino acids 289-398 of human ATG4A (NP_443168.2). TEENGTVNDQTFHCLQSPQRMNILNLDPSVALGFFCKEEKDFDNWCSLVQKEILKENLRMFELVQKHPSHWPPFVPPAKPEVTTTGAEFIDSTEQLEEFDLEEDFEILSV
Conjugation:	Unconjugated
Alternative Names:	ATG4A, AUTL2, Autophagin-2, APG4A, Autophagin 2, Cysteine protease ATG4A, HAPG4A, APG4 autophagy 4 homolog A

ATG4A antibody LS-C332196 is an unconjugated rabbit polyclonal antibody to ATG4A from human. It is reactive with human and mouse. Validated for IHC, IP and WB.

Clonality:	Polyclonal
NCBI:	115201
Buffer:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Purity:	Affinity purified
Form:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Dilute:	IHC (1:50 - 1:200), IP (1:20 - 1:100), WB (1:500 - 1:2000)
Application Notes:	The predicted MW is 36kDa/38kDa/42kDa/45kDa, while the observed MW by Western blot was 46kDa.

	Western blot analysis of extracts of various cell lines.
	Immunoprecipitation analysis of extracts of K562 cells.

* VAT and and shipping costs not included.
Errors and price changes excepted