Polyclonal Rabbit anti-Human ATG4A Antibody (IHC, WB) LS-C332196

Artikelnummer: LS-C332196-20

Bilder (2)
Sehen Sie alle Bilder und Bildinformationen

Artikelname:	Polyclonal Rabbit anti-Human ATG4A Antibody (IHC, WB) LS-C332196
Artikelnummer:	LS-C332196-20
Hersteller Artikelnummer:	LS-C332196-20
Alternativnummer:	LS-C332196-20
Hersteller:	LifeSpan Biosciences
Wirt:	Rabbit
Kategorie:	Antikörper
Applikation:	IHC, IP, WB
Spezies Reaktivität:	Human, Mouse
Immunogen:	Recombinant fusion protein containing a sequence corresponding to amino acids 289-398 of human ATG4A (NP_443168.2). TEENGTVNDQTFHCLQSPQRMNILNLDPSVALGFFCKEEKDFDNWCSLVQKEILKENLRMFELVQKHPSHWPPFVPPAKPEVTTTGAEFIDSTEQLEEFDLEEDFEILSV
Konjugation:	Unconjugated
Alternative Synonym:	ATG4A, AUTL2, Autophagin-2, APG4A, Autophagin 2, Cysteine protease ATG4A, HAPG4A, APG4 autophagy 4 homolog A

ATG4A antibody LS-C332196 is an unconjugated rabbit polyclonal antibody to ATG4A from human. It is reactive with human and mouse. Validated for IHC, IP and WB.

Klonalität:	Polyclonal
NCBI:	115201
Puffer:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit:	Affinity purified
Formulierung:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Verdünnung:	IHC (1:50 - 1:200), IP (1:20 - 1:100), WB (1:500 - 1:2000)
Anwendungsbeschreibung:	The predicted MW is 36kDa/38kDa/42kDa/45kDa, while the observed MW by Western blot was 46kDa.

	Western blot analysis of extracts of various cell lines.
	Immunoprecipitation analysis of extracts of K562 cells.

* Mehrwertsteuer und Versandkosten nicht enthalten.
Irrtümer und Preisänderungen vorbehalten