Polyclonal Rabbit anti-Human RPL5 / Ribosomal Protein L5 Antibody (IHC, IF, WB) LS-C331799

Catalog Number: LS-C331799-20
Article Name: Polyclonal Rabbit anti-Human RPL5 / Ribosomal Protein L5 Antibody (IHC, IF, WB) LS-C331799
Biozol Catalog Number: LS-C331799-20
Supplier Catalog Number: LS-C331799-20
Alternative Catalog Number: LS-C331799-20
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Application: IF, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human RPL5 (NP_000960.2). MGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDIICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNY
Conjugation: Unconjugated
Alternative Names: RPL5, 60S ribosomal protein L5, DBA6, L5, Ribosomal protein L5, MSTP030
Ribosomal Protein L5 antibody LS-C331799 is an unconjugated rabbit polyclonal antibody to Ribosomal Protein L5 (RPL5) from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB.
Clonality: Polyclonal
NCBI: 6125
Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Purity: Affinity purified
Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Dilute: IF (1:50 - 1:200), IHC (1:50 - 1:200), WB (1:500 - 1:2000)
Application Notes: The predicted MW is 34kDa, while the observed MW by Western blot was 37kDa.
Western blot analysis of extracts of various cell lines.
Immunohistochemistry of paraffin-embedded mouse liver tissue.
Immunofluorescence analysis of U2OS cells.