Polyclonal Rabbit anti-Human RPL5 / Ribosomal Protein L5 Antibody (IHC, IF, WB) LS-C331799

Artikelnummer: LS-C331799-20

Bilder (3)
Sehen Sie alle Bilder und Bildinformationen

Artikelname:	Polyclonal Rabbit anti-Human RPL5 / Ribosomal Protein L5 Antibody (IHC, IF, WB) LS-C331799
Artikelnummer:	LS-C331799-20
Hersteller Artikelnummer:	LS-C331799-20
Alternativnummer:	LS-C331799-20
Hersteller:	LifeSpan Biosciences
Wirt:	Rabbit
Kategorie:	Antikörper
Applikation:	IF, IHC, WB
Spezies Reaktivität:	Human, Mouse, Rat
Immunogen:	Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human RPL5 (NP_000960.2). MGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDIICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNY
Konjugation:	Unconjugated
Alternative Synonym:	RPL5, 60S ribosomal protein L5, DBA6, L5, Ribosomal protein L5, MSTP030

Ribosomal Protein L5 antibody LS-C331799 is an unconjugated rabbit polyclonal antibody to Ribosomal Protein L5 (RPL5) from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB.

Klonalität:	Polyclonal
NCBI:	6125
Puffer:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit:	Affinity purified
Formulierung:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Verdünnung:	IF (1:50 - 1:200), IHC (1:50 - 1:200), WB (1:500 - 1:2000)
Anwendungsbeschreibung:	The predicted MW is 34kDa, while the observed MW by Western blot was 37kDa.

	Western blot analysis of extracts of various cell lines.
	Immunohistochemistry of paraffin-embedded mouse liver tissue.
	Immunofluorescence analysis of U2OS cells.

* Mehrwertsteuer und Versandkosten nicht enthalten.
Irrtümer und Preisänderungen vorbehalten