Polyclonal Rabbit anti-Human RPL5 / Ribosomal Protein L5 Antibody (IHC, IF, WB) LS-C331799

Catalog Number: LS-C331799-100

Images (3)
See all images and image information

Article Name:	Polyclonal Rabbit anti-Human RPL5 / Ribosomal Protein L5 Antibody (IHC, IF, WB) LS-C331799
Biozol Catalog Number:	LS-C331799-100
Supplier Catalog Number:	LS-C331799-100
Alternative Catalog Number:	LS-C331799-100
Manufacturer:	LifeSpan Biosciences
Host:	Rabbit
Category:	Antikörper
Application:	IF, IHC, WB
Species Reactivity:	Human, Mouse, Rat
Immunogen:	Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human RPL5 (NP_000960.2). MGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDIICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNY
Conjugation:	Unconjugated
Alternative Names:	RPL5, 60S ribosomal protein L5, DBA6, L5, Ribosomal protein L5, MSTP030

Ribosomal Protein L5 antibody LS-C331799 is an unconjugated rabbit polyclonal antibody to Ribosomal Protein L5 (RPL5) from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB.

Clonality:	Polyclonal
NCBI:	6125
Buffer:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Purity:	Affinity purified
Form:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Dilute:	IF (1:50 - 1:200), IHC (1:50 - 1:200), WB (1:500 - 1:2000)
Application Notes:	The predicted MW is 34kDa, while the observed MW by Western blot was 37kDa.

	Western blot analysis of extracts of various cell lines.
	Immunohistochemistry of paraffin-embedded mouse liver tissue.
	Immunofluorescence analysis of U2OS cells.

* VAT and and shipping costs not included.
Errors and price changes excepted