Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human RPL5 (NP_000960.2). MGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDIICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNY
Konjugation:
Unconjugated
Alternative Synonym:
RPL5, 60S ribosomal protein L5, DBA6, L5, Ribosomal protein L5, MSTP030
Ribosomal Protein L5 antibody LS-C331799 is an unconjugated rabbit polyclonal antibody to Ribosomal Protein L5 (RPL5) from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB.