Human LTA protein

Catalog Number: BYT-ORB705222
Article Name: Human LTA protein
Biozol Catalog Number: BYT-ORB705222
Supplier Catalog Number: orb705222
Alternative Catalog Number: BYT-ORB705222-20,BYT-ORB705222-100,BYT-ORB705222-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
This Human LTA protein spans the amino acid sequence from region 35-205aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molecular Weight: 20.8 kDa
UniProt: P01374
Buffer: Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Source: Homo sapiens (Human)
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL
Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized LTA at 5 µg/ml can bind human TNFRSF1B , the EC50 is 1.632-2.699 ng/ml.Measured by its binding ability in a functional ELISA. Immobilized LTA at 5 µg/ml can bind human TNFR1, the EC50 of human LTA protein is 4.409-6.797 ng/ml. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
orb705222
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
orb705222
Measured by its binding ability in a functional ELISA. Immobilized LTA at 5 µg/ml can bind human TNFRSF1B, the EC50 is 1.632-2.699 ng/ml.
Measured by its binding ability in a functional ELISA. Immobilized LTA at 5 µg/ml can bind human TNFR1, the EC50 of human LTA protein is 4.409-6.797 ng/ml.