Human LTA protein
Artikelnummer:
BYT-ORB705222
- Bilder (5)
| Artikelname: | Human LTA protein |
| Artikelnummer: | BYT-ORB705222 |
| Hersteller Artikelnummer: | orb705222 |
| Alternativnummer: | BYT-ORB705222-20,BYT-ORB705222-100,BYT-ORB705222-1 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| This Human LTA protein spans the amino acid sequence from region 35-205aa. Purity: Greater than 95% as determined by SDS-PAGE. |
| Molekulargewicht: | 20.8 kDa |
| UniProt: | P01374 |
| Puffer: | Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Quelle: | Homo sapiens (Human) |
| Reinheit: | Greater than 95% as determined by SDS-PAGE. |
| Formulierung: | Lyophilized powder |
| Sequenz: | LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL |
| Anwendungsbeschreibung: | Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized LTA at 5 µg/ml can bind human TNFRSF1B , the EC50 is 1.632-2.699 ng/ml.Measured by its binding ability in a functional ELISA. Immobilized LTA at 5 µg/ml can bind human TNFR1, the EC50 of human LTA protein is 4.409-6.797 ng/ml. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference |
|
|
orb705222 |
|
|
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. |
|
|
orb705222 |
|
|
Measured by its binding ability in a functional ELISA. Immobilized LTA at 5 µg/ml can bind human TNFRSF1B, the EC50 is 1.632-2.699 ng/ml. |
|
|
Measured by its binding ability in a functional ELISA. Immobilized LTA at 5 µg/ml can bind human TNFR1, the EC50 of human LTA protein is 4.409-6.797 ng/ml. |
Produktgarantie und fachkundiger Support
