Human IL15 protein

Catalog Number: BYT-ORB594793
Article Name: Human IL15 protein
Biozol Catalog Number: BYT-ORB594793
Supplier Catalog Number: orb594793
Alternative Catalog Number: BYT-ORB594793-10,BYT-ORB594793-50,BYT-ORB594793-500,BYT-ORB594793-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Interleukin-15, IL-15, IL15
This Human IL15 protein spans the amino acid sequence from region 49-162aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molecular Weight: 12.5 kDa
UniProt: P40933
Buffer: Lyophilized from a 0.2 µm filtered 20 mM PB, 150 mM NaCl, pH 7.0
Source: Homo sapiens (Human)
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: The ED50 as determined in a cell proliferation assay using CTLL-2 mouse cytotoxic T cells is 40-200pg/ml. Application Notes: Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.




* VAT and and shipping costs not included.
Errors and price changes excepted
Availability
ORDER BY EMAIL
Product Guarantee and Expert Support
BIOZOL