Human IL15 protein

Artikelnummer: BYT-ORB594793
Artikelname: Human IL15 protein
Artikelnummer: BYT-ORB594793
Hersteller Artikelnummer: orb594793
Alternativnummer: BYT-ORB594793-10,BYT-ORB594793-50,BYT-ORB594793-500,BYT-ORB594793-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Interleukin-15, IL-15, IL15
This Human IL15 protein spans the amino acid sequence from region 49-162aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molekulargewicht: 12.5 kDa
UniProt: P40933
Puffer: Lyophilized from a 0.2 µm filtered 20 mM PB, 150 mM NaCl, pH 7.0
Quelle: Homo sapiens (Human)
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: The ED50 as determined in a cell proliferation assay using CTLL-2 mouse cytotoxic T cells is 40-200pg/ml. Application Notes: Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.




* Mehrwertsteuer und Versandkosten nicht enthalten.
Irrtümer und Preisänderungen vorbehalten
Verfügbarkeit
PER E-MAIL BESTELLEN
Produktgarantie und fachkundiger Support
BIOZOL