Human IL17A protein

Catalog Number: BYT-ORB594787
Article Name: Human IL17A protein
Biozol Catalog Number: BYT-ORB594787
Supplier Catalog Number: orb594787
Alternative Catalog Number: BYT-ORB594787-10,BYT-ORB594787-50,BYT-ORB594787-500,BYT-ORB594787-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Interleukin-17A, IL-17, IL-17A, Cytotoxic T-Lymphocyte-Associated Antigen 8, CTLA-8, IL17A, CTLA8, IL17
This Human IL17A protein spans the amino acid sequence from region 24-155aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molecular Weight: 15.26 kDa
UniProt: Q16552
Buffer: Lyophilized from a 0.2 µm filtered 20 mM PB, pH 7.4
Source: Homo sapiens (Human)
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: The ED50 as determined by its ability to induce IL-6 secretion by NIH-3T3 mouse embryonic fibroblast cells is 1-7 ng/ml. Application Notes: Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.




* VAT and and shipping costs not included.
Errors and price changes excepted
Availability
ORDER BY EMAIL
Product Guarantee and Expert Support
BIOZOL