Human IL17A protein

Artikelnummer: BYT-ORB594787
Artikelname: Human IL17A protein
Artikelnummer: BYT-ORB594787
Hersteller Artikelnummer: orb594787
Alternativnummer: BYT-ORB594787-10,BYT-ORB594787-50,BYT-ORB594787-500,BYT-ORB594787-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Interleukin-17A, IL-17, IL-17A, Cytotoxic T-Lymphocyte-Associated Antigen 8, CTLA-8, IL17A, CTLA8, IL17
This Human IL17A protein spans the amino acid sequence from region 24-155aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molekulargewicht: 15.26 kDa
UniProt: Q16552
Puffer: Lyophilized from a 0.2 µm filtered 20 mM PB, pH 7.4
Quelle: Homo sapiens (Human)
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: The ED50 as determined by its ability to induce IL-6 secretion by NIH-3T3 mouse embryonic fibroblast cells is 1-7 ng/ml. Application Notes: Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.