Human IL13 protein

Catalog Number: BYT-ORB594786
Article Name: Human IL13 protein
Biozol Catalog Number: BYT-ORB594786
Supplier Catalog Number: orb594786
Alternative Catalog Number: BYT-ORB594786-10,BYT-ORB594786-50,BYT-ORB594786-500,BYT-ORB594786-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Interleukin-13,IL-13,
This Human IL13 protein spans the amino acid sequence from region 25-146aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molecular Weight: 13.4 kDa
Buffer: Lyophilized from a 0.2 µm filtered solution of PBS,PH7.4.
Source: Homo sapiens (Human)
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN
Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: The ED50 as determined in a cell proliferation assay using TF-1 human erythroleukemic cells is 1.5-4.5 ng/ml. Application Notes: Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.




* VAT and and shipping costs not included.
Errors and price changes excepted
Availability
ORDER BY EMAIL
Product Guarantee and Expert Support
BIOZOL