Human IL13 protein

Artikelnummer: BYT-ORB594786
Artikelname: Human IL13 protein
Artikelnummer: BYT-ORB594786
Hersteller Artikelnummer: orb594786
Alternativnummer: BYT-ORB594786-10,BYT-ORB594786-50,BYT-ORB594786-500,BYT-ORB594786-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Interleukin-13,IL-13,
This Human IL13 protein spans the amino acid sequence from region 25-146aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molekulargewicht: 13.4 kDa
Puffer: Lyophilized from a 0.2 µm filtered solution of PBS,PH7.4.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: The ED50 as determined in a cell proliferation assay using TF-1 human erythroleukemic cells is 1.5-4.5 ng/ml. Application Notes: Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.