Mouse Il33 protein

Catalog Number: BYT-ORB594779
Article Name: Mouse Il33 protein
Biozol Catalog Number: BYT-ORB594779
Supplier Catalog Number: orb594779
Alternative Catalog Number: BYT-ORB594779-10,BYT-ORB594779-50,BYT-ORB594779-500,BYT-ORB594779-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Interleukin 33, IL-33, IL33, C9orf26, NKHEV, Interleukin-1 family member 11, DVS27, NF-HEV and IL- 1F11
This Mouse Il33 protein spans the amino acid sequence from region 109-266aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molecular Weight: 17.6 kDa
UniProt: Q8BVZ5
Buffer: Lyophilized from a 0.2 µm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Source: Mus musculus (Mouse)
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI
Application Notes: Biological Origin: Mus musculus (Mouse). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Mouse IL-33 at 5µg/ml can bind Mouse ST2-Fc, the ED50 of Mouse ST2-Fc is 0.33 ug/ml. Application Notes: Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.




* VAT and and shipping costs not included.
Errors and price changes excepted
Availability
ORDER BY EMAIL
Product Guarantee and Expert Support
BIOZOL