Mouse Il33 protein

Artikelnummer: BYT-ORB594779
Artikelname: Mouse Il33 protein
Artikelnummer: BYT-ORB594779
Hersteller Artikelnummer: orb594779
Alternativnummer: BYT-ORB594779-10,BYT-ORB594779-50,BYT-ORB594779-500,BYT-ORB594779-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Interleukin 33, IL-33, IL33, C9orf26, NKHEV, Interleukin-1 family member 11, DVS27, NF-HEV and IL- 1F11
This Mouse Il33 protein spans the amino acid sequence from region 109-266aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molekulargewicht: 17.6 kDa
UniProt: Q8BVZ5
Puffer: Lyophilized from a 0.2 µm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Mouse IL-33 at 5µg/ml can bind Mouse ST2-Fc, the ED50 of Mouse ST2-Fc is 0.33 ug/ml. Application Notes: Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.




* Mehrwertsteuer und Versandkosten nicht enthalten.
Irrtümer und Preisänderungen vorbehalten
Verfügbarkeit
PER E-MAIL BESTELLEN
Produktgarantie und fachkundiger Support
BIOZOL