Human IFNA2 protein

Catalog Number: BYT-ORB594773
Article Name: Human IFNA2 protein
Biozol Catalog Number: BYT-ORB594773
Supplier Catalog Number: orb594773
Alternative Catalog Number: BYT-ORB594773-10,BYT-ORB594773-50,BYT-ORB594773-500,BYT-ORB594773-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Interferon Alpha-2, IFN-Alpha-2, Interferon Alpha-A, LeIF A, IFNA2
This Human IFNA2 protein spans the amino acid sequence from region 24-188aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molecular Weight: 19.4 kDa
UniProt: P01563
Buffer: Lyophilized from a 0.2 µm filtered 20 mM PB, 150 mM NaCl, pH 7.2
Source: Homo sapiens (Human)
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: The ED50 as determined by a viral resistance assay using VSV-WISH cells is less than 10 pg/mL. Application Notes: Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.




* VAT and and shipping costs not included.
Errors and price changes excepted
Availability
ORDER BY EMAIL
Product Guarantee and Expert Support
BIOZOL