Human IFNA2 protein

Artikelnummer: BYT-ORB594773
Artikelname: Human IFNA2 protein
Artikelnummer: BYT-ORB594773
Hersteller Artikelnummer: orb594773
Alternativnummer: BYT-ORB594773-10,BYT-ORB594773-50,BYT-ORB594773-500,BYT-ORB594773-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Interferon Alpha-2, IFN-Alpha-2, Interferon Alpha-A, LeIF A, IFNA2
This Human IFNA2 protein spans the amino acid sequence from region 24-188aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molekulargewicht: 19.4 kDa
UniProt: P01563
Puffer: Lyophilized from a 0.2 µm filtered 20 mM PB, 150 mM NaCl, pH 7.2
Quelle: Homo sapiens (Human)
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: The ED50 as determined by a viral resistance assay using VSV-WISH cells is less than 10 pg/mL. Application Notes: Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.




* Mehrwertsteuer und Versandkosten nicht enthalten.
Irrtümer und Preisänderungen vorbehalten
Verfügbarkeit
PER E-MAIL BESTELLEN
Produktgarantie und fachkundiger Support
BIOZOL