Mouse Csf2 protein

Catalog Number: BYT-ORB594719
Article Name: Mouse Csf2 protein
Biozol Catalog Number: BYT-ORB594719
Supplier Catalog Number: orb594719
Alternative Catalog Number: BYT-ORB594719-10,BYT-ORB594719-50,BYT-ORB594719-500,BYT-ORB594719-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Granulocyte-Macrophage Colony-Stimulating Factor, GM-CSF, Colony-Stimulating Factor, CSF,Molgramostin, Sargramostim, CSF2, GMCSF
This Mouse Csf2 protein spans the amino acid sequence from region 18-141aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molecular Weight: 15.1 kDa
UniProt: P01587
Buffer: Lyophilized from a 0.2 µm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Source: Mus musculus (Mouse)
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQK
Application Notes: Biological Origin: Mus musculus (Mouse). Biological Activity: The ED50 as determined in a cell proliferation assay using PDC-P1 cells is 40-170 pg/ml. Application Notes: Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.




* VAT and and shipping costs not included.
Errors and price changes excepted
Availability
ORDER BY EMAIL
Product Guarantee and Expert Support
BIOZOL