Mouse Csf2 protein

Artikelnummer: BYT-ORB594719
Artikelname: Mouse Csf2 protein
Artikelnummer: BYT-ORB594719
Hersteller Artikelnummer: orb594719
Alternativnummer: BYT-ORB594719-10,BYT-ORB594719-50,BYT-ORB594719-500,BYT-ORB594719-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Granulocyte-Macrophage Colony-Stimulating Factor, GM-CSF, Colony-Stimulating Factor, CSF,Molgramostin, Sargramostim, CSF2, GMCSF
This Mouse Csf2 protein spans the amino acid sequence from region 18-141aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molekulargewicht: 15.1 kDa
UniProt: P01587
Puffer: Lyophilized from a 0.2 µm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQK
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Biological Activity: The ED50 as determined in a cell proliferation assay using PDC-P1 cells is 40-170 pg/ml. Application Notes: Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.




* Mehrwertsteuer und Versandkosten nicht enthalten.
Irrtümer und Preisänderungen vorbehalten
Verfügbarkeit
PER E-MAIL BESTELLEN
Produktgarantie und fachkundiger Support
BIOZOL