Human CSF1 protein

Catalog Number: BYT-ORB594716
Article Name: Human CSF1 protein
Biozol Catalog Number: BYT-ORB594716
Supplier Catalog Number: orb594716
Alternative Catalog Number: BYT-ORB594716-10,BYT-ORB594716-50,BYT-ORB594716-500,BYT-ORB594716-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Macrophage Colony-Stimulating Factor 1, CSF-1, M-CSF, MCSF, Lanimostim, CSF1
This Human CSF1 protein spans the amino acid sequence from region 33-255aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molecular Weight: 26.17 kDa
UniProt: P09603
Buffer: Lyophilized from a 0.2 µm filtered 20 mM PB, 150 mM NaCl, pH 7.2
Source: Homo sapiens (Human)
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCNCLYPKAIPSSDPASVSPHQPLAPSMAPVAGLTWEDSEGTEGSSLLPGEQPLHTVDPGSAKQRPPR
Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: The ED50 as determined in a cell proliferation assay using M-NFS-60 mouse myelogenous leukemia lymphoblast cells is less than 4.16 ng/ml. Application Notes: Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.




* VAT and and shipping costs not included.
Errors and price changes excepted
Availability
ORDER BY EMAIL
Product Guarantee and Expert Support
BIOZOL