Human CSF1 protein

Artikelnummer: BYT-ORB594716
Artikelname: Human CSF1 protein
Artikelnummer: BYT-ORB594716
Hersteller Artikelnummer: orb594716
Alternativnummer: BYT-ORB594716-10,BYT-ORB594716-50,BYT-ORB594716-500,BYT-ORB594716-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Macrophage Colony-Stimulating Factor 1, CSF-1, M-CSF, MCSF, Lanimostim, CSF1
This Human CSF1 protein spans the amino acid sequence from region 33-255aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molekulargewicht: 26.17 kDa
UniProt: P09603
Puffer: Lyophilized from a 0.2 µm filtered 20 mM PB, 150 mM NaCl, pH 7.2
Quelle: Homo sapiens (Human)
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCNCLYPKAIPSSDPASVSPHQPLAPSMAPVAGLTWEDSEGTEGSSLLPGEQPLHTVDPGSAKQRPPR
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: The ED50 as determined in a cell proliferation assay using M-NFS-60 mouse myelogenous leukemia lymphoblast cells is less than 4.16 ng/ml. Application Notes: Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.




* Mehrwertsteuer und Versandkosten nicht enthalten.
Irrtümer und Preisänderungen vorbehalten
Verfügbarkeit
PER E-MAIL BESTELLEN
Produktgarantie und fachkundiger Support
BIOZOL