CHRNA7 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB592778
- Images (6)
| Article Name: | CHRNA7 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB592778 |
| Supplier Catalog Number: | orb592778 |
| Alternative Catalog Number: | BYT-ORB592778-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | WB |
| Species Reactivity: | Human, Rat |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N terminal region of human CHRNA7 |
| Conjugation: | Unconjugated |
| Alternative Names: | NACHRA7, CHRNA7-2 |
| Rabbit polyclonal antibody to CHRFAM7A |
| Clonality: | Polyclonal |
| Concentration: | 1.0 mg/ml |
| Molecular Weight: | 56 kDa |
| NCBI: | 000737 |
| UniProt: | P36544 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: QGEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQV |
| Target: | CHRNA7 |
|
|
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. |
|
|
Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1 ug/ml. |
|
|
Sample Tissue: Human Jurkat, Antibody Dilution: 1.0 ug/ml. |
|
|
Sample Type: MDA-MB-435S Cell lysates, Antibody Dilution: 1.0 ug/ml. |
|
|
Sample Tissue: Rat Brain, Antibody Dilution: 1 ug/ml. |
|
|
WB Suggested Anti-CHRNA7 Antibody Titration: 2.5 ug/ml, Positive Control: HepG2 cell lysate. |
Product Guarantee and Expert Support
