CHRNA7 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB592778
- Bilder (6)
| Artikelname: | CHRNA7 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB592778 |
| Hersteller Artikelnummer: | orb592778 |
| Alternativnummer: | BYT-ORB592778-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | WB |
| Spezies Reaktivität: | Human, Rat |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N terminal region of human CHRNA7 |
| Konjugation: | Unconjugated |
| Alternative Synonym: | NACHRA7, CHRNA7-2 |
| Rabbit polyclonal antibody to CHRFAM7A |
| Klonalität: | Polyclonal |
| Konzentration: | 1.0 mg/ml |
| Molekulargewicht: | 56 kDa |
| NCBI: | 000737 |
| UniProt: | P36544 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: QGEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQV |
| Target-Kategorie: | CHRNA7 |
|
|
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. |
|
|
Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1 ug/ml. |
|
|
Sample Tissue: Human Jurkat, Antibody Dilution: 1.0 ug/ml. |
|
|
Sample Type: MDA-MB-435S Cell lysates, Antibody Dilution: 1.0 ug/ml. |
|
|
Sample Tissue: Rat Brain, Antibody Dilution: 1 ug/ml. |
|
|
WB Suggested Anti-CHRNA7 Antibody Titration: 2.5 ug/ml, Positive Control: HepG2 cell lysate. |
Produktgarantie und fachkundiger Support
