STAT3 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB592766
- Images (6)
| Article Name: | STAT3 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB592766 |
| Supplier Catalog Number: | orb592766 |
| Alternative Catalog Number: | BYT-ORB592766-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the middle region of human STAT3 |
| Conjugation: | Unconjugated |
| Alternative Names: | APRF, HIES, ADMIO, ADMIO1 |
| Rabbit polyclonal antibody to STAT3 |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 88kDa |
| NCBI: | 644805 |
| UniProt: | P40763 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: FGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTIDLPMSPRTLD |
| Target: | STAT3 |
|
|
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The peptide is also present in a 83 kDa isoform.The protein may be modified by acetylation and phosphorylation. |
|
|
Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 1 ug/ml. |
|
|
Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 3 ug/ml. |
|
|
Human Uterus |
|
|
Immunohistochemistry with Thymus tissue at an antibody concentration of 5.0 ug/ml using anti-STAT3 antibody (orb592766). |
|
|
WB Suggested Anti-STAT3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: 721_B cell lysate. STAT3 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells. |
Product Guarantee and Expert Support
