STAT3 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB592766
- Bilder (6)
| Artikelname: | STAT3 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB592766 |
| Hersteller Artikelnummer: | orb592766 |
| Alternativnummer: | BYT-ORB592766-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the middle region of human STAT3 |
| Konjugation: | Unconjugated |
| Alternative Synonym: | APRF, HIES, ADMIO, ADMIO1 |
| Rabbit polyclonal antibody to STAT3 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 88kDa |
| NCBI: | 644805 |
| UniProt: | P40763 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: FGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTIDLPMSPRTLD |
| Target-Kategorie: | STAT3 |
|
|
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The peptide is also present in a 83 kDa isoform.The protein may be modified by acetylation and phosphorylation. |
|
|
Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 1 ug/ml. |
|
|
Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 3 ug/ml. |
|
|
Human Uterus |
|
|
Immunohistochemistry with Thymus tissue at an antibody concentration of 5.0 ug/ml using anti-STAT3 antibody (orb592766). |
|
|
WB Suggested Anti-STAT3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: 721_B cell lysate. STAT3 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells. |
Produktgarantie und fachkundiger Support
