CCL18 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB592730
- Images (6)
| Article Name: | CCL18 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB592730 |
| Supplier Catalog Number: | orb592730 |
| Alternative Catalog Number: | BYT-ORB592730-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the middle region of human CCL18 |
| Conjugation: | Unconjugated |
| Alternative Names: | CKb7, PARC, AMAC1, DCCK1, MIP-4, AMAC-1, DC-CK1, SCYA18 |
| Rabbit polyclonal antibody to CCL18 |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 10kDa |
| NCBI: | 002979 |
| UniProt: | P55774 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: PQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA |
| Target: | CCL18 |
|
|
Sample Tissue: Human HT1080 Whole Cell, Antibody Dilution: 1 ug/ml. |
|
|
Sample Type: Fetal Lung lysates, Antibody Dilution: 0.5 ug/ml. |
|
|
Sample Type: Fetal Lung lysates, Antibody Dilution: 1.0 ug/ml. |
|
|
Sample Type: Fetal Lung lysates, Antibody Dilution: 1.0 ug/ml. |
|
|
Positive control (+): Human lung (LU), Negative control (-): HepG2 (HG), Antibody concentration: 1 ug/ml. |
|
|
Human Intestine |
Product Guarantee and Expert Support
