CCL18 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB592730
- Bilder (6)
| Artikelname: | CCL18 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB592730 |
| Hersteller Artikelnummer: | orb592730 |
| Alternativnummer: | BYT-ORB592730-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the middle region of human CCL18 |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CKb7, PARC, AMAC1, DCCK1, MIP-4, AMAC-1, DC-CK1, SCYA18 |
| Rabbit polyclonal antibody to CCL18 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 10kDa |
| NCBI: | 002979 |
| UniProt: | P55774 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: PQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA |
| Target-Kategorie: | CCL18 |
|
|
Sample Tissue: Human HT1080 Whole Cell, Antibody Dilution: 1 ug/ml. |
|
|
Sample Type: Fetal Lung lysates, Antibody Dilution: 0.5 ug/ml. |
|
|
Sample Type: Fetal Lung lysates, Antibody Dilution: 1.0 ug/ml. |
|
|
Sample Type: Fetal Lung lysates, Antibody Dilution: 1.0 ug/ml. |
|
|
Positive control (+): Human lung (LU), Negative control (-): HepG2 (HG), Antibody concentration: 1 ug/ml. |
|
|
Human Intestine |
Produktgarantie und fachkundiger Support
