GPM6A Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB586134
- Images (7)
| Article Name: | GPM6A Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB586134 |
| Supplier Catalog Number: | orb586134 |
| Alternative Catalog Number: | BYT-ORB586134-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human, Rat |
| Conjugation: | Unconjugated |
| Alternative Names: | M6A, GPM6 |
| Rabbit polyclonal antibody to GPM6A |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 31kDa |
| NCBI: | 005268 |
| UniProt: | P51674 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: IAMVHYLMVLSANWAYVKDACRMQKYEDIKSKEEQELHDIHSTRSKERLN |
| Target: | GPM6A |
|
|
Antibody dilution: 1.0 ug/ml, Sample Type: Human brain. |
|
|
Sample Tissue: Human Brain, Antibody dilution: 1 ug/ml. |
|
|
Positive control (+): Human Liver (LI), Negative control (-): Human Stomach Tumor (T-ST), Antibody concentration: 3 ug/ml. |
|
|
Lanes: Lane 1: 250 ug rat hippocampal culture neurons, Lane 2: 200 ug rat hippocampal culture neurons, Lane 3: 100 ug rat hippocampal culture neurons, Lane 4: 50 ug rat hippocampal culture neurons, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:8000, Gene Name: GPM6A. |
|
|
Lanes: Lane 1: 400 ug rat hippocampal, Lane 2: 300 ug rat hippocampal, Lane 3: 200 ug rat hippocampal, Lane 4: 100 ug rat hippocampal, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:8000, Gene Name: GPM6A. |
|
|
Primary Antibody dilution: 1:250, Secondary Antibody: Anti-rabbit-AlexaFluor 488, Secondary Antibody dilution: 1:1000, Color/Signal Descriptions: GPM6A: Green DAPI: Blue, Gene Name: GPM6A. |
|
|
Primary Antibody dilution: 1:250, Secondary Antibody: Anti-rabbit-AlexaFluor 488, Secondary Antibody dilution: 1:1000, Color/Signal Descriptions: GPM6A: Green DAPI: Blue, Gene Name: GPM6A. |
Product Guarantee and Expert Support
