Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz:
Synthetic peptide located within the following region: IAMVHYLMVLSANWAYVKDACRMQKYEDIKSKEEQELHDIHSTRSKERLN
Target-Kategorie:
GPM6A
Antibody dilution: 1.0 ug/ml, Sample Type: Human brain.
Sample Tissue: Human Brain, Antibody dilution: 1 ug/ml.
Positive control (+): Human Liver (LI), Negative control (-): Human Stomach Tumor (T-ST), Antibody concentration: 3 ug/ml.
Lanes: Lane 1: 250 ug rat hippocampal culture neurons, Lane 2: 200 ug rat hippocampal culture neurons, Lane 3: 100 ug rat hippocampal culture neurons, Lane 4: 50 ug rat hippocampal culture neurons, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:8000, Gene Name: GPM6A.
Lanes: Lane 1: 400 ug rat hippocampal, Lane 2: 300 ug rat hippocampal, Lane 3: 200 ug rat hippocampal, Lane 4: 100 ug rat hippocampal, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:8000, Gene Name: GPM6A.