G6PC3 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB586015
- Images (6)
| Article Name: | G6PC3 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB586015 |
| Supplier Catalog Number: | orb586015 |
| Alternative Catalog Number: | BYT-ORB586015-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | WB |
| Species Reactivity: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N-terminal region of Human G6PC3 |
| Conjugation: | Unconjugated |
| Alternative Names: | SCN4, UGRP |
| Rabbit polyclonal antibody to G6PC3 |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 39kDa |
| NCBI: | 612396 |
| UniProt: | Q9BUM1 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: ESGYYSQAPAQVHQFPSSCETGPGSPSGHCMITGAALWPIMTALSSQVAT |
| Target: | G6PC3 |
|
|
Sample Type: Hela, Antibody dilution: 1.0 ug/ml. G6PC3 is strongly supported by BioGPS gene expression data to be expressed in HeLa. |
|
|
Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml. |
|
|
Positive control (+): MCF7 (N10), Negative control (-): Human Placenta (PL), Antibody concentration: 1 ug/ml. |
|
|
WB Suggested Anti-G6PC3 Antibody, Titration: 1.0 ug/ml, Positive Control: 721_B Whole Cell. G6PC3 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells. |
Product Guarantee and Expert Support
