G6PC3 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB586015
- Bilder (6)
| Artikelname: | G6PC3 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB586015 |
| Hersteller Artikelnummer: | orb586015 |
| Alternativnummer: | BYT-ORB586015-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | WB |
| Spezies Reaktivität: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N-terminal region of Human G6PC3 |
| Konjugation: | Unconjugated |
| Alternative Synonym: | SCN4, UGRP |
| Rabbit polyclonal antibody to G6PC3 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 39kDa |
| NCBI: | 612396 |
| UniProt: | Q9BUM1 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: ESGYYSQAPAQVHQFPSSCETGPGSPSGHCMITGAALWPIMTALSSQVAT |
| Target-Kategorie: | G6PC3 |
|
|
Sample Type: Hela, Antibody dilution: 1.0 ug/ml. G6PC3 is strongly supported by BioGPS gene expression data to be expressed in HeLa. |
|
|
Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml. |
|
|
Positive control (+): MCF7 (N10), Negative control (-): Human Placenta (PL), Antibody concentration: 1 ug/ml. |
|
|
WB Suggested Anti-G6PC3 Antibody, Titration: 1.0 ug/ml, Positive Control: 721_B Whole Cell. G6PC3 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells. |
Produktgarantie und fachkundiger Support
