P4HA2 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB585255
- Images (6)
| Article Name: | P4HA2 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB585255 |
| Supplier Catalog Number: | orb585255 |
| Alternative Catalog Number: | BYT-ORB585255-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | WB |
| Species Reactivity: | Human |
| Conjugation: | Unconjugated |
| Alternative Names: | MYP25 |
| Rabbit polyclonal antibody to P4HA2 |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 58kDa |
| NCBI: | 001017973 |
| UniProt: | O15460 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: VYESLCRGEGVKLTPRRQKRLFCRYHHGNRAPQLLIAPFKEEDEWDSPHI |
| Target: | P4HA2 |
|
|
Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Fetal Kidney, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml. |
|
|
WB Suggested Anti-P4HA2 Antibody, Titration: 1.0 ug/ml, Positive Control: HepG2 Whole Cell. |
Product Guarantee and Expert Support
