P4HA2 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB585255
- Bilder (6)
| Artikelname: | P4HA2 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB585255 |
| Hersteller Artikelnummer: | orb585255 |
| Alternativnummer: | BYT-ORB585255-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | WB |
| Spezies Reaktivität: | Human |
| Konjugation: | Unconjugated |
| Alternative Synonym: | MYP25 |
| Rabbit polyclonal antibody to P4HA2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 58kDa |
| NCBI: | 001017973 |
| UniProt: | O15460 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: VYESLCRGEGVKLTPRRQKRLFCRYHHGNRAPQLLIAPFKEEDEWDSPHI |
| Target-Kategorie: | P4HA2 |
|
|
Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Fetal Kidney, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml. |
|
|
WB Suggested Anti-P4HA2 Antibody, Titration: 1.0 ug/ml, Positive Control: HepG2 Whole Cell. |
Produktgarantie und fachkundiger Support
